Universidad catholica de Louvain, Facultad de Medicina 

biologia molecular, Cochabamba, Bolivia, abril 2006
la molécula de ADN: ejercicios
Jean-Pierre HERVEG* y Maritza BARCIA-MACAY**
*Université de Louvain, Unité GECE, Christian de DUVE Intitute of cellular Pathology (ICP), Brussels, Belgium.


plan
pdf Genomics y pdf N. Guillén
a continuación


Identification of proteins interacting with purified brush
border from human enterocytes

The first peptide, LYLPYYFSVTK, corresponded to the E. histolytica Gal/GalNAc lectin Igl1 and Igl2 proteins (amino acids 457­467 of locus 53.m00171/119.m00118 respectively). Igl is a 150 kDa protein family that interacts with the Gal/GalNAc lectin complex (Cheng et al., 1998). The protein must have been proteolysed on the amoeba surface or during the experiment leading to a molecular weight of 75 kDa instead of 150 kDa.

from "A lysine- and glutamic acid-rich protein, KERP1, from Entamoeba histolytica binds to human entero"
by
Marie Seigneur, Joelle Mounier, Marie-Christine Prevost and Nancy Guillén
in Cellular Microbiology (2005) 7, (4), 56


a continuación


Isolation of BB:

Isolation of BB from Caco2 cells was based on standard protocols used to obtain BB from intestinal mucosa (Keller and Mooseker, 1982).

cell cuture:
Briefly, 3 ¥ 107 cells grown for 14 days were washed in PBS, washed in buffer A (Imidazole 10 mM pH 7.4, EDTA 5 mM, EGTA 1 mM, DTT 0.2 mM and protease inhibitor from Sigma), incubated for 20 min in buffer A and scraped.

homoenisation:
After centrifugation during 5 min at 300 g the cell pellet was resuspended in 0.5 ml of buffer A and passed once through the cell cracker (EMBL, Precision Engineering, Heidelberg, Germany).
Cell homogenate was adjusted to 4 ml with buffer A and centrifuged for 10 min at 1000 g. The pellet was washed three times in buffer A, and twice in buffer B.

BBisolation
Brush borders were isolated from contaminated nuclei by resuspending the final pellet in 42% sucrose in buffer B and layered on a cushion of 50% sucrose before centrifugation at 45 000 g. Brush borders were collected at the interface of the two sucrose solutions. The quality of the preparation was monitored by light microscopy.
E. histolytica crude protein extracts
Total E. histolytica crude protein extracts were obtained from 106 trophozoites. These were washed in PBS and lysed in 50 ml of 10 mM Tris (pH 7.5), protease inhibitor mixture [10 mM leupeptine (Sigma), 1 mM N-ethylmaleimide (Sigma), 2 mM p-chloromercuribenzoate (Sigma), 2 mM 4-(2-aminoethyl) benzenesulphonyl fluoride (Uptima), complete mini EDTA-free (protease inhibitor cocktail, Roche)] and 1% SDS at 100C for 10 min. Entamoeba histolytica cytoplasm, vesicles and internal membranes and plasma membranes were isolated using the amoebaspecific sugar gradient separation technique (Aley et al., 1980). Biotinylation coupled to streptavidin revelation of trophozoite surface proteins were made as described by Andrews and Bjorvatn (1991).

Brush border from differentiated Caco2 cells was purified and coated on affigel beads. Purified biotinylated parasite plasma membrane proteins were submitted to interaction with these beads. After elution, we recovered a fraction enriched in biotinylated proteins interacting with the BB, indicating that the conditions used for this affinity chromatography were useful. Nevertheless, abundant parasite proteins were still bound to the beads especially the Gal/GalNAc lectin. In preparative experiments using non-biotinylated proteins, we succeeded in recovering proteins with molecular masses of roughly 75, 37 and 20 kDa

a continuación

The three bands recovered from acrylamide gel were endolysine digested, the peptides were separated by HPLC and the amino acid sequence of some peptides was successfully determined. Computer search for protein identity by using the peptide sequences allowed us to determine the nature of some proteins revealed in this experiment.


LYLPYYFSVTK
Leu-Tyr-Leu-ProTyr-Tyr-Phe-Ser-Val-Thr-Lys
http://www.tigr.org/tdb/e2k1/eha1/
Sequence Search
Gene Name Search
Contig Name Search
----> Locus Search
HMM Search


a continuación

 53.m00171
119.m00118
Gal/GalNAc lectin complex
 

a continuación

53.m00171Gal/GalNAc lectin subunit Igl1
MFILLLFISISLGDYTADKLIGGKEPREAVPHCASVSNGACTSCDTGYELTTTGNNKTCT
LKEDMCKTAFSYYDKTNSTNPKCTYCVNGKEVNTSSHSGNDKCVCKNNVNICESCLLMKD
SKCGECIIGMSTTVDGSKLCDNATTEDHAENCVGLLASSTSSKTCDKCFGMYSLQGGKCT
QKNDKINKCILQVENSCNQCADGYSLSTDKKSCNKFPEHCSKINGNQCLTCMEGYYLSKT
DSKCTICTVDNPNNLSEGNECSIYNAEHCTSCNKRCTVSDGVCVKNHCRLFSPTEENKCT
KCDNGYFLTTSGTCSPNLYDGFKTANRTECENGYYLEKDGDKKRCSLCPDPFTECLTSKT
PVPGKLNLRSSHLTSTDGPCKLPGCLLCSDDDTICYKCENGLTLNGTHCYNFDTKSVLGT
SGNNHQVCKMRGYDQYEQYLNAFKASDNTYYCPLKDLYLPYYFSVTKGTSDNTITIGCVG
QLRNVSNDCECNDKHIPTSIDKASDCVSITTKLPSCERTANGNICTQCPVGSHVGKDGKC
SCGDAHYFDKDNVCKKCPASCSSCSYDSSKSKVVCSECYENIQGVTTRNKENECACINDG
YKEGPNAEDKKKSCAQLNNNCKKEGKYEISDGFVTCLDCDDSAYIVGSQVGACTQCSPNA
FKDENNKCQLCSTKQSQYGHCAACSATACITCEDINLILTGEKPCTVCKDGFYQIENATD
GVYCSPCPAKCKTCKYNTTSKKVECVTCTEQRLKDIKAPECACPTGTVQLENGTCQSCSD
LSKYPGCKKTDSCNVDSRTGFIYATECSDGFSGRSPYSNCTTCTKSNYYPKEGEKNGCAK
CDDKCATCSDKDTCLTCADPLKVGSKCDGCKTGYYMSNGECKPCTNHCSECSSAAECTVC
ESDTYKVISGNGCNSCVDGFYFDEIKGTCIPCTSPCTKCVGVKKDCEEQETGCNSEKKKI
VEECTKCSTKDHIAEVPVNGACVCAYGYVEGTSTEDNKIECQACKAKVNEFCDSCNSKDC
LRCNAEYLEAKGGECVCVEGYYTSSWGSCIPCSRHMPHCTKCTGEGECTTCEDGWKLKDG
KCNGAKGIFIMMMIVMLAFMF
119.m00118 Gal/GalNAc lectin subunit Igl2
MFILLLFISISLGDYTADKLINNQEPRTAVPHCASVSNGACASCDEGYELKTESGSGSTQ
KCTLKEETCKSAFSYYDGSDSNSPKCVYCENGKESDTSSSNNEKCKCKNGVDTCESCLSK
DNDKCGECVIGMSTTTNGGQKLCDTVTTDEHAENCVGLTAKDSSSKQCDKCFGMYSLQSG
QCTKKNEKIEKCILQVESSCNQCADGYYINTEKKCTKYPDHCSKMNSDKCNGCMEGYYLN
GTECKVCTIDNSKDLSEGNECSIYNAEHCESCNKRCTVSDGVCVKNHCRLFSPTEENKCT
KCDDGYFLTGAGKCSPNLNDGFKTSAKTECQKGYYLEKDGDKKRCSLCPDPFTECLTSQT
PVPGKLNLRSAHLTSTDGPCKLPGCLLCSDDDTICYKCENGLTLNGTHCYNFDVKKVLGT
SGNNHQVCKMRGYDQYEQYLNAFKASDNTYYCPLKDLYLPYYFSVTKGSDNKITIGCVGK
DRDVKNDCECNDKYIPKSVDKASDCVSIKTKLPSCERAANENICTQCPVGSHVDSNGKCS
CGDAHYFDQNNKCQECPASCSSCSYDSSKSKVVCSECYENIQGVSTRDKDNECACKKDTP
EYKEGLNAEDKKKSCAQLNNNCKEEGHYKISDGFITCLECDDSAYIVDSQTKECAQCASN
AFKDENNKCQLCSTKKDKYGHCSACSATACIICEDTNLVLAASGSNAQCTVCKDGFYQIE
SPTDGVYCSPCPAKCKTCKYSADKKEIECVTCTDQSSVDIKPPTCACLTGTVQLENGTCQ
SCSDLSKYPGCKTTDTCNVDSRTGYIYATECSDGFSGRSPYSNCTTCIESNYYPKEGEKN
GCAKCDDKCATCSDKDTCLTCTDPLKIGSKCDECKTGYYMSNGECKPCTNHCSECSSAAE
CTVCESDTYKVISGNGCNACVDGFYFDEIKGTCIPCTSPCTKCVGVKKDCEEQETGCNSE
KKKIVEECTKCSTKDHIAEVPVNGACVCAYGYVEGTSTEDNKIECQSCKAKVNEFCDSCN
SKDCLRCNAEYLEAKGGECVCVEGYYTSSWG

a continuación
GTLELDELLK
467.m00030 and 54.m00192
AEEIVEFL
134­142 of locus 76.m00139 of E. histolytica
EIVEMINELANALNK,
TITILNAQPPLK, ILLEEEEGEAPTPK and DIFYEN
30­44, 45­56, 140­153 and 179­184, respectively, of locus 77.m00174.
 

a continuación

http://tigrblast.tigr.org/er-blast/index.cgi?project=eha1
 

a continuación

   

plan

biologia molecular, Cochabamba, Bolivia, abril 2006
la molécula de ADN: ejercicios
Jean-Pierre HERVEG* y Maritza BARCIA-MACAY**
*Université de Louvain, Unité GECE, Christian de DUVE Intitute of cellular Pathology (ICP), Brussels, Belgium.

Universidad catholica de Louvain, Facultad de Medicina